PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009107174.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Trihelix
Protein Properties Length: 962aa    MW: 107912 Da    PI: 7.2548
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009107174.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix25.14.4e-081792322275
        trihelix  22 rrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtses 75 
                     +rgk ++ + +ev++++ + g++r +k    kw+n+ ++++k++e+ek++  e+
  XP_009107174.1 179 GRGKTRAEKDREVAEFLNRNGVNRDSKIAGTKWDNMLGEFRKVNEWEKGGDREK 232
                     3567999999**************************************985444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd001805.00E-10808951No hitNo description
SuperFamilySSF561121.1E-13810951IPR011009Protein kinase-like domain
Gene3DG3DSA:1.10.510.102.0E-6810914No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 962 aa     Download sequence    Send to blast
MGETTKGDAT KPSPNQISSP KDSSLDHQTP TPSPIHHHHQ SFHPSPIFIS TVSSPGAPII  60
PKRPRFISSS GLSPPQWKAL PSPSTLPTAA TFPSLPSPST AVVAASSTET AASSPLEQEG  120
INTEKQQLET ESFQHKFRKG KYVSPVWKPH EMLWLAKAWR VQYQKQETGP GSGSGSGEGR  180
GKTRAEKDRE VAEFLNRNGV NRDSKIAGTK WDNMLGEFRK VNEWEKGGDR EKYGKSYFRL  240
SPYERKQHRL PASFDEEVYQ ELALFMGPRA RALSIKRSSG GAPADVTLTP PPAETFPPIL  300
HPPFMTSRDD DVDNNRITSI GRGKRLALSI AGDDHPQYPY THNIGRGSGL FSNRSLYYNP  360
SCERIPSSSS SSSSLKDLRR VGKIRLTWEE SVNLWAEEGE VDYGRIRVSG SSFLNADELT  420
YLDDSMVACT MESFEDGPLR GFSLDKFISG QHLKVFGRQK STSSSAPSPS VNMANSIDRA  480
QLPLAVPINK SISTLEFQDP SEHYLSSLRV PAANPPSLFE LGRYLQEPPP ENLRFPIRRD  540
VYKDLPPGKE LFFSTSTTEL LDCRAVTYDI ISPVMFRLSP NSVISSKDSL IPLWDDCVNR  600
MVSKFCDMVV LRKPDSSSFV ENVQDQWPNV VGFVKGFGLW RGEEVEKVRE GAAVPSSLLV  660
KKILWSYDDL PYILGYHAIG FTVTFCALSR SSQDRVVCTD LYSFDVSSPS DRIKALVPCY  720
RLASLLHLLA DRCTMRHLCY NDFERISHRD FVTEITPNTV TKYYSSKRKW SVVKGIYDFL  780
DQRVPHAEHL NSAREKELSL SFKPRGVRVK PCNVDQLIES LMCVTRALVA LHDLSFMHRD  840
MRWENVMRSA EMTTTTSDAE WFVCGFDEAA ESPQLNPHRS MDEEEEEENG RQAPEMERGL  900
HAVKVDVWGV GYMIKTCGLT NVPKMLRELQ GKCLEPNQEN RPTAADCFHH LLQVQSASSS  960
SY
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009107174.10.0PREDICTED: uncharacterized protein LOC103832832
TrEMBLA0A0D3EA640.0A0A0D3EA64_BRAOL; Uncharacterized protein
STRINGBra028276.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM83561624
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33550.17e-08Trihelix family protein